GenomeNet

>mcys:MCB1EB_0946 K21929 uracil-DNA glycosylase [EC:3.2.2.27] | (GenBank) uracil-DNA glycosylase-related protein (A)
MPEPDSILEELGLTPVWRTRTASTIGAAESAAAEACPSVDVKAPKKEFEVISEPISEVSE
TPISLLDWDTLKARVANCTRCRLCEKRNHTVFGIGDEKASWMLVGEAPGANEDRLGEPFV
GQAGKLLDNMLGAVGRTRENGIYIANVIKCRPPGNRDPQLDEVAQCEPYLKRQLAIIRPQ
LILALGRFAAQSLLKTDASISSLRTRVHQYEGVPVIVTYHPAYLLRNLPDKAKAWADLCR
AQEIYQAMNH

BLAST