GenomeNet

>meti:DK427_01690 K15011 two-component system, sensor histidine kinase RegB [EC:2.7.13.3] | (GenBank) two-component sensor histidine kinase (A)
MPDSDPSRLLRDARHLRLDTFVRLRWLAIAGQSAAVVGAQFGLGLSLPFGWCFLAIAASS
WLNLGLRIRFPASYRLNDDAAALLLAFDIVQLAALLFLTGGLQNPFSLLFLAPVLISATA
LPPERTLALGLLAVGLATLLALVHRPLPWFADGRIELPFLYVSGVWTAILLGTAFTGVYA
WRVSEETRQLAQALAATELVLAREQHLSQLDGLAAAAAHELGTPLGTILVVTKELVRQLG
PAATPAVREDLDLLREQVDRCRGILGKLTSLGSDGDGGGFLETVTLGQIVEELAAPQRAL
GVVLDVSGRGEGPEPACRRNPGVMYGLANILDNAIDFSEARVTLEARWTLDRVSLEIRDD
GPGFPSEVLLRAGEPYITTRSPERRDDDDAWNRGGLGLGLFIAKTLIERSGAQITLSNAA
GPGNHGAVVRISWARHIFERGAAPRHSPELPRPAPLPTGDAAPI

BLAST