GenomeNet

>metl:U737_23340 K07090 uncharacterized protein | (GenBank) sulfite exporter TauE/SafE family protein (A)
MNLMYTASGFAVGMLVGVTGVGGGSLMTPLLVFLFGFKPAVAVGTDLLYASITKTAGVFV
HHGKHGSVDWKIVGWLALGSLPFAGVTLYVLKNLMEVGKEVTGAITFTLGVALLLTALAL
LVRSILLRKASKSAEIDDEHSNQGNSGRFSPRWEKVATVFTGAVLGVLVTLSSVGAGALG
TVALLFLYPRMTTLKIVGTDLAHAIPLTAVAGLGHLSLGNFDLDLLISLLLGSVPGIWVG
SHLSAKIPEYFLRPVLATLLLVIGLKFVLQ

BLAST