GenomeNet

>mho:MHO_4880 K12132 eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1] | (GenBank) sps1; Serine/threonine protein kinase (A)
MNKIKELPGMFVLNKYFTDFELIGTGGFGEVYSATYKKNNKRVAIKILNCIDDSRWTEQR
TRFINEINILKEIHSSNVVKILGWHYKGNEVFYVMELIKGQGLKTIIAKNKKIDPDTAIM
YAKQICQGLIEIHAAKIVHRDLKPSNILIDEETNSLKLIDFGISIGESTQRVTRNYKAVG
SVQYMAPELLRGIADPSPRSDIYAFGIILFEMLEGKVPFNNHDDINQIMMMHINNELPRM
SDVNVIIPQALENIVIRCTAKSAEQRYADCVELMHDLETCLDSKRVNEKRLELNPSKSKM
KAKRIFNSKLFNIIFFTTGGFLVAFIVIFVVLFLKGIL

BLAST