GenomeNet

>mmu:14707 K04542 guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 | (RefSeq) Gng5, G(y)5; guanine nucleotide binding protein (G protein), gamma 5 (A)
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL

BLAST