GenomeNet

>mmu:19353 K04392 Ras-related C3 botulinum toxin substrate 1 | (RefSeq) Rac1, AL023026, D5Ertd559e; Rac family small GTPase 1 (A)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

BLAST