GenomeNet

>mmu:66066 K04546 guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 | (RefSeq) Gng11, 0610037B21Rik; guanine nucleotide binding protein (G protein), gamma 11 (A)
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS

BLAST