GenomeNet

>mpsy:CEK71_07580 K00239 succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4] | (GenBank) succinate dehydrogenase flavoprotein subunit (A)
MATSYKIIEHAYDVIVVGAGGAGLRATFGMAEKGLKTACLTKVFPTRSHTVAAQGGISAA
LGNMGEDDWRFHMYDTVKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAEGKIYQ
RAFGGMTTHYGKGQAQRTCAAADKTGHAILHTLYQQALKHNAEFFVEYIALDLIMQDGEC
RGVLAWCLDDGSLHLFKAHQTVLATGGYGRSYFSCTSAHTVTGDGNAMVLRAGLPLQDME
FVQFHPTGIYGSGCLITEGVRGEGGYLTNSQGERFMERYAPSAKDLASRDVVSRAMTIEI
NEGRGVGKLKDHIYLHIEHLDPAIIHERLPGIAETSKIFAGVDVTKEPIPVLPTVHYNMG
GIPTNYKAEVVTLEAGNPDKIVPGLMAIGEAACVSVHGANRLGSNSLLDLIVFGRSAAIR
CAELIKPGSSHKPLNKDACDQALTRFDKIRNANGSRSSSDIRLDMQRVMQTKAAVFRTQA
TLDEGITAMADISASFADVTVKDKSLIWNTDLVETLELDNLLAQANVTINAAGNRKESRG
GHAREDYPNRDDANWMKHTLTWLTDGKVSIDYRPVHLYTLSDDVEVIPPKERVY

BLAST