GenomeNet

>mrr:Moror_8959 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (GenBank) succinate dehydrogenase flavoprotein subunit (A)
MFKKALPRAILRSHRSLHTSAPVRRVVSTSPVKAQEVQSWSSGKYPLIEHEYDAIVVGAG
GAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHMYDTVKGS
DWLGDQDAIHYMCREAPRTVIELEHFGVPFSRTKDGKIYQRAFGGQSLKYGKGGQAYRCA
AAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAH
KTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSH
LPAEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTIDEHGKD
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKAIPEEAG
IESIQFLDKIRTADGPIPTAKIRLDMQKAMQSDAAVFRTQQTLDEGVEKMRAIYKSFDRV
GIKDRSMIWNSDLVETLELRNILQNAIQTIESAAARKESRGAHAREDYPERDDDNWMKHT
LSFQRDASSPDVELKYRGVINTTLDENECKPVPPFKRVY

BLAST