GenomeNet

>msn:LI99_27260 no KO assigned | (GenBank) serine/threonine protein kinase (A)
MPLASGQVFAGFTIVRLVGTGGMGEVYLAKHPRLPREDALKVLPISVSADDEFRQRFIRE
ADMAATLWHPHIVGVHDRGEFEGRLWISMDYVDGHDAARLLHDKYPKGMPADDVVEIVTA
VGDALDYAHQRQLLHRDVKPANILVTEKHGTKRRIMLTDFGIARRTDDVNGLTSTNITVG
SMSYTSPEQLMGQPLDGRADQYSLAATAYRLLTGAPPFSHSNPAVVISHHLNSPPPKLGD
TKPALAKLDSVMAKALAKDAKDRFDTCHDFAVALAEANKGDESAAPVTAAPPPVITPPVQ
TAPPTTPLKAQTLPAPPTPPTPLSPSNPQAPTASQPPVFTSSWAGHDDPSGRQPVAVPAP
APPPPPPPSNFGPPPPAYSPPPRKSGGDRRKLIIAAAAIGAVVLLVGGITLAVTSGGDND
SAGAAATTSETASETPVTTTPKKPGEHAYTIADYIRDNKISETPVHRGDPNTPELTMPTP
PGWADAGTRTPAWAYSAIVNDPASPTDPPSVISLISKLDGNVDPEKLLEFAPNELQNLTE
WEPIGGVTRSNLSGFPSVQLGGSYLKDGKRRAITQKTVVVDIPSGIYVLQINADSLYRDF
GALVDVNKAIDKEATIKP

BLAST