GenomeNet

>mun:110565033 K17514 C-type lectin domain family 6 member A | (RefSeq) Clec6a; C-type lectin domain family 6 member A (A)
MVQERQRRGKGVCWMLRLWSVAVISILLLSACFVASCVLTYQFTTDNPNRRLFELHTYHS
SISCFSEGTMVSEKMWGCCPNHWKPFGSSCYLISTKENFWSISEQNCVEMGAHLVVINTE
AEQALAITPLLPGFYEFDYFRVFMFWHPNEPNSPAERCASIVFWNPAKWAWNDVLCDTKR
RSICEMKKIYL

BLAST