GenomeNet

>myb:102249742 K05292 GPI-anchor transamidase subunit T | (RefSeq) PIGT; phosphatidylinositol glycan anchor biosynthesis class T (A)
MAAAVRLPVLVLXLLGRGGWGHAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLIAKYSLRELHLSLTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDTSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSMLLKADRLFHSSYHSQAVHIRPICRNARCTSISWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITSYSQDNETLEVNPPP
LTTYQDVILGTRKTYAVYDLLNTAVINSSRNLNLQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQSGELSTLLYNTHPYRAFPVLLLDIVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPASSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSVVA
AKPVDWEESPLFSSLFPVSDSSSYFMRLYTEPLLVSLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL

BLAST