GenomeNet

>mze:101482510 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hexokinase-1 isoform X2 (A)
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDIMNRFRREMENGLERDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQIYETPDDITH
GSGAQLFDHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKKFKASGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTTGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDNGSLEDIRTEFDREIDRGSINPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVQHVCTIVSFRSANLISATLGAILCRLKENKGVVRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTEQARHIQQTLAEFRLS
KNQLLEVKKRMKVEIERGLKKDSHKDATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIEIVPGTEGRMCVNMEWGAFGDNGCLDD
IRTTYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRRLDHLDVTVGVDGTLYKLHPHFSRIFQQTVKELAPKCDVNFLLSEDGSGKG
AALITAVGCRQRELDAQQH

BLAST