GenomeNet

>nba:CUN60_06205 K05366 penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4] | (GenBank) hypothetical protein (A)
MKIFRGHLLLRILYNWKKLKKSVKEYRQAKFDNEILNLPNHFFDVLLLAEDHRFRRHIGV
DFIALLRSIYKSLIVREKQGGSTIAMQLVRTITNDREQTVFRKVREIVLAIILTSYLNKD
DILIMYMRIAYFGWNMEGLESACIKLKIDINNIEISDAVLLVSRLKYPEPRFENKNQSFK
IYNRINYLYKRFVNR

BLAST