GenomeNet

>ndk:I601_0369 no KO assigned | (GenBank) Putative DNA ligase-like protein (A)
MDLPVMPPVRPMLAKAVKTVPDPAKHGGLSFEPKWDGFRCLVFRDGDEVELTSRNTKPLT
RYFPELVVAALEQLPERCVLDGEVFVALPTPDGGQRLEFEVLQERIHPAASRVEMLSQKT
PAGFVAFDLLALGDESYVDRPFAERRAALEAALAHLSGGDGPCHLTRTTTDPAVAEQWLD
EFEGAGLDGVVAKPLGAAYVENARTMLKIKHERTADVVLAGMREHKTSTAERPLLGSMLL
GLWTDGEDGPVLQHIGVSASFTETRRAELWTELEPLACAIDEHPWARWHEGAIANPDRVP
GTQSRWSAGKDLSFVPLRPERVLEVKYDHMEGRRFRHTAHFKRWREDRDPASCGYDQLDD
VVGYDLGQVLGSD

BLAST