GenomeNet

>nek:CGZ77_03180 K02045 sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3] | (GenBank) sulfate ABC transporter ATP-binding protein (A)
MSITIENLDKHFGAFHALKNISLTAPTGKLTSLLGPSGCGKTTLLRIIAGLENADGGKIL
FDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTVKPRAERPSKEQIRAKVEAL
LSLVRLGHLAKAYPHQLSGGQRQRIALARALAVEPKLLLLDEPFGALDAKVRKELRTWLR
DIHHELGITSILVTHDQEEALEVSDQIVVMNHGRIEQTGSADDIYLRPANAFVTGFLGHT
EAFEGRIEKGAWHYGNYARPLDTQRRWQEQTATAYIRPHEWQINETRPMLAAALVHIRHS
GALAHLTLRLEDGRQIQADLPAAEAARLNLQPGQTLPLAPRQIYVFGQSELIDYAI

BLAST