GenomeNet

>nfa:NFA_8110 no KO assigned | (GenBank) hypothetical protein (A)
MAELPGYLRWLEWVAGSDWPAGEPEGMWGIADDWRTAAQGLREILDDIDAAKSASLAAYP
QGEGIDKMVTMFDDLRSGDQSLEKLAENFDLIAESADGVGTEIEYAQLMMITSLAILAAE
IAAAWIFPPTAPAVQAAAIGVTRVGIRMLAQQVMNRIIQWTARLVGRKVATFLVRHMAID
TFIGTFQEVGIQAYQVEFGRRPDINWEQVAVTAVSSAAGGAAASPFGDWIAKKLPAAMPN
WLSGAVTGATAGAVGAGAGFAASVATQFGIDAYQDGWDKAWENAKNTEFDPRMLTAGVSN
GAMSGASRAMADGFYHNRHPEWYPAPSQDPPRPEPRIGGTPPGFDPAGNGTDPGGTGNAD
GGHTNGTGPVGGNQNGTDPAGSTGAGADRAGIAPETTAPGTAAPEAGPAGEPASQTSPAA
GATPPETGAADPTTPRGEGSTAPADGETAPGRAADHAPPDEGGAGTRGESDGEGRTDADG
RPAVDADTAGDGRGETDGEATRSGSDPSTPGDRAATPESADGGARTAALEASPAAAPSDT
GAVPGADAAAGAPRPDAAFEASPAAAPSDTGADAAAPRSDAEEASPAAIQSDTGAPRGDT
AAPRDAGHPSTSAPEGPTGGSADGTAAPRVLDGTAPARPDSAPQPTGTAFGFPGAAPISG
ATPPPGALPAAAPPSAVTPGTGAAPASSTPGTTPGTGSSPAGSLAQHTPGQHGTDRPSAP
GESRQTPGPAARPSAAPAARAGIADGTSPFGREGGVQARHADAPAPLAERSVAQDVSSED
AESVQVPPEGMLAVPPLVADLAAPRAGRTDSADRPASRPTPEDSDRVAGDDRARPSRAGT
DAPTTPRADDPNRDGGTSSDPDRVGAPHHDSDPARRGRCAPLSLGEIADATGSTSIRVPE
HVGPEGLSAAELEHYAGGRLHGVPTPADPAAPRHQALADLLLSEDNLATWALVVDEYRGP
VDEYGVGAHAYVLSVQVDPATGARSVVVSDPATGVRRGFPPVVPPELGRVHAILFDAGGH
ALPEDAAHPLADLIGEGGARIGRSADEHRDQIRELLALTPTGRDILATLDSGPVRDAYER
GAEDGRVGSFRRGALAAVAFTEGNSHLRQALALAHESVHAQRFVDGQTAHTRDGMRSMSR
DDYVRAMIEEEAAATGRRFQLARELRTLGFDIPTNQLEAVYTDAYERAELGLSRSEPELP
PAEVARIAHEVAVDALRGPLAHYEFDNGVTYTRFYGEAWDRVRLPPAHGADAPNADLVFR
PTDAGVVQDLRRAVLALRADLLALEDISQRLTALAATVDVDATAPRQVFDARIAERLADL
AAGGRARDSDPARAAELRRVEHDLRTLSGLADQRDAAQRAVDERSRDLGLRAAREYVHAR
AESTPDARVLTDQIVLVPGEPDRVLVAAPPGEHPAVLDGARTDPELAALLDRAEVEPFEV
RVDNDGRVLLDAVDPRAMPGADPRPSPEGSADRPEGAVAPRDPAGAAADARIARVRAELG
TTEVGRWADDVLDRAGVQVVYGSDGADRYLPARRTLRLDVGATDAEQMVALVHGAIHADT
AHARDTPGGARERMLLPRAEYVGRMLDEETRAHALEIVARLQLRAAGHDLPVTDLERAYT
RAFDAARAAAVREHPDAPAHDLDRRANEAGLRALRPLVADLPADPTGITYGEAYGADWDR
SHGIRPFDALVRTALAAGEVSAQIRHEGTSVNSARRVELVTFTDGTQLIRKTMINSRHAD
AEQLFSALARAVGAPVPEVFRAGRNVVYLRPVPGVTAHQRWPGFLDPHELGALDSDAGRA
LGLADALAGVPDRDASGWMVDSDGGIHGIGNHRAFEGTVTPATLSPFASHFLRATADGAL
EPVEHPLTDREMADLRERVAALRPEFERLGRPRWLDGALATLDALAEHARPAPPPDPGLP
VDAGEDDLVYVNRYGGTGRHGISGVVDADGVLHYEIRAGRATPSGREMFADMMRELGHAV
RAIEDDWFAEGGFDDQLATFNAAIQDTFATPEEAALSTFTGRLAAELGFTRVEFGPDGLE
GPLGENTAVTVRFLRPEEALPAPDLRPSEGGRTDRPLGMPPFTSRDTDNPTRPVDRDRGT
DAVDPPEFPAERGAGDADADRAAAAQQRRAELDRLAADRDAAVRDREHALAAGDRERAEA
ARERIDRLGEQIGAAIERDALAGVDARPLTDRVGVIDGARPVVVVANRGGADVRALLAEA
AGRHPELARLLADPEVTVRELRIDESGRVAVVRVENPGPVGRSDDPGAPSAPAETPPLAA
DGGAGKPPSEPPVSAGPDPGEPDPGAGSTRRDWTADGPARTHQPTTDRARRDLAGAGERI
ADAVATRRMAEERLADLARQAGIDPDGRTPHQLSRLADDLLAAAEARVDALHGRTAVPRE
EIVRYFDELRAAQAELGRTVRAVGALRAEVGRWTAAARAEDEARTTAGVLAARDVLTAEG
TRMISEGVGLAPDGQRVVVASPLTRPDAVMPAEVRRMLADRGVAVDYRLVAVDAAGRVTV
TDLRPPAAEAEPATGPESARPDPARSAAEPRPRVRQPDTSAEQPVRPRPAGPDTDVTPEP
TAPPARPDGGPDDYGALLRDRAALASEREFWRAKRDDRADRLGLADPDRELGPDRLEPTL
QRLLGEVVGTRETAGTGEELPGRTPELVGSAELSQRRERIFRLQDAAERFIAASDALAEV
DRRIAALEAAGAGAGRHPTAEVAAELDRLGRERAGQVLALKPWRVMRDDIAARLRVDPDR
LGPEDLPATLDEVANRRVRADEIELRMRNLRLLAEAAEQVNRRENEIGRVQDRITELAGS
ARALFDAAGARPITDRVGLVDGPNPRIVVVGPRGRWDAPFADHDAALAEALRRSGAVAQA
MVRPETTIEYRQIVADRDGTWQPVDLAPPRREFIDAPPSNGRPGIHLTRWRDGDGEWHHV
DTARPDWSAGRDESGVPKKFEPRDLPEGVSGWAVNPFQAAVVDPFVDPSGGTPAGAINES
FLPTIPGGMPPGDIPSYSLPFADAFYHTMRIILESAKLSGFTWYSDSEHPGRIRPGFKGH
PWFRAPRADVQPMVREWNAADRIPDDGNLTRPFLDRQEAARQRWARVQAWADEQYRTFRA
DDSDITRIADNLADRAAADRIAHARELIDRVRAVLRGDAEVDALVDDLTGALADERPGDA
ARLVADLLDVVGRPMDPADHAEVTRLVADQLADRGPTFTAEDIERIKNHLMRDEHLIRDP
HDGTLVRRPLDAVADVAEAWHRLLAGEPLPQDILLLQDARAESDFLRDNPIATWRDANQH
AISLGYDWNADRPPLTDWRANIPYAPAPVGPQAPPAAGPPASRPESSEEQPGRPPATPAP
ATPEPPDDSASPPHPEAEATRPELPPAPPELPTSRAEPQPTRGERPPTQPALTPPVPAES
AGVSETRPDTALPAAVSDPVEGMPSADDGRASAAPARSRSVVPEETGSPTTESNGGAGRP
PSDPPTRGAPDPDEPSEWLRARLAEQEEWNARMRAELAEWAARMRDGAVAREFEGLQREI
DDAFAAIDRRLAEHRAAEQRRTEEFFADLARRAGLPWSTEEPATRPDAEPPPAGADAGRP
PDDDAVPNRTDPADDSRPPVPTPDEPSEWLRARLAEQEEWNARMRAELAEWAARMRDGAV
AREFDGIQREIDAAFDDIERRLAEQRADERRRNDEFFDELLRRVALPWAPADPATEGQVD
PRRGSEDDPDNRAETPTGGEHHTRDDGAHHPERGGRRDDPTDPEDGTDGAAGHPADPPSR
PPAAPSAAAPESVPDQVAPVPEDERSTGELAAGDSAERDGPAAWSPVGPGQEVAPPSEAV
ARELRALGERAAAAAARRADIERQLLRQVGELPIDRADLSVEEVVRAAEEHLREARARED
ELRDGWDVALDEVDGHQRAVAEAAHLADRAGRVVEAIRAAIRERAEAIRAEHDARMTAGV
LAARAVLDAEGVRMIGEGVGLSPDGRRVLIASPLADPGVLLPPETRALLARNNVEIDYRL
VEVDGAGRITATPIAPPRTPETWSTPESTAEAPPSREPDEHRSRLREQLDGLRERRAEAA
DRAERLRDEIADLARSTADDPTTDAATTEADVVARRVRDLAEAEAEVARLDEMLDYLRTA
ATPDTDHEALLREQARLTSEREFWRAKRDDRADRLGLADPDRELGPDRLEPTLQRLLGEV
VGTRETAGTGEELPGRTPELVGSAELSQRRERIFRLQDAAERFIAASDALAEVDRRIAAL
EAARGLPDRSRAAEVAAQLEQLGRERAGQVLALKPWRVMRDDIAARLRVDPDRLGPEDLT
ATLDEVAGRQVRADELELRARNLELLAEAADQVNRRENEIGRLQDRMAELAGADREIFDT
AGARGITDRVGLVDGPNPRIVVVGPRGRWDAPFADHDAALADALRHSAAVAQAMVRPETT
IEYRQIVADRDGTWQPVDLPSPRREFVDAPPRNGGPGIHLTRWRDGAGEWHEVNTSRPDW
STGRDESGVPKKFEPRDLPEGVSGWAVNPFQAAVVDPFVDPSGGTPAGAVNESFLPTIPG
GMPPGDVPSYSLPFADVFYHTMRIILESAKLSGFTWYSDSANPGRIRPGFKGHPWFRAPR
PDVQPMVREWNAADRIPDDGNLGPEYRARQQAAREQWARVQAWADEQYRIFRDMGADDLA
AIFDNLTEAARADRAARAQDLIQRLRELAAQDDPDVEAVIAELTGTLPDEQPGDAARLVT
DLLAVVGRPADALRPDELVELVAQQLGADEPEFTWEELQRIKNHLMHDEHLIRDPEDGTL
VRRRLDAVADVAEAWHRLMNGDHLPQDLLLLRDARAESDFLRDNPIATWRDANQHAISLG
YDWNADRPPLTDWRANIPYAPAPVGPQAPPTRPTPPPIPPSTPGNAASPGPGADHRTRPA
DTAPHRPSEAATTPADDPAALSPEITGDGGESGPRPARPDGTIRADDRAALSPEGIADDG
ESGPQPARPDGTTDDRAAPSPEVTGEYGETSPARPDGTIRTEEPPPDEDEGDDPPAAAPP
AGPPSQPPAAPPAAGDPGDPGDEGDAHRARESATAAESTDSASRDAPPEARGADASSEST
DRVDTSETTPVDPAPEPRPAAPTRPAADPTAPPAADTQSQRRDAVPNRLAADIEAAVRER
DAARTAGDDRAVEATTERIERLAGALLSANAQHALRAAGAHLVGSRVGVLGGEPPRYLVA
GWGGADTGAALADALAADPALAELLRLPGVEIRELRLTIDENGAIGAHLVDPPASAADRG
DQTADRDTVGQPPATAPESDAPQRDHTRVGAGEPANPGDDPARDSADDPGTRDSAQAEAR
RAHAEALARRDELAARIRELGERLPIREPEALDPDHIAATVRELSTWNLSEPDQVAALAE
LVDLVPGFLEAHADAALLAARIGLLDDYDRLLAEHKELVREREFVRAKADERAEHLLGTD
DPPWTTRDSDSRDDAIRARYAEARTDLIDIPAGPDEVGHQERRLADPDDVRERRRALEKL
IETTGRFDDLAEQVRQVEQRLADLENAGIAQYRPPTAEVADRLDTLARERAAELRRIKPR
RAMRDDLALRLGVVDDTGAPDEPALSRDLDRTLADLRARVAADLRSGALPVNELPARLRA
IAALADAAPEVARAHNRIGRLQDEMAGLAGAWRTQIEAEGGRMVTDRVGIVEGERPRIVV
FGPRPDPESPRAEHDRAFEAALRTAAPVAQAVVRPETTVEYRRVLADRQGEVRSETMPPP
EVERLSAGGVGGRRLDMTQWRDAEGTWHPVDPTRPDWTTGRDSGTLPKKFTPKDPPDGVS
GWAMEDVVNDITLPTDDVPPGQIPESTLPVNAPMAPSQYSTGGVPDGATVFGQHWGADSY
NVVRLILMAAQVPKHPAVQAWFQRHPEIGRWVQARPWLRHIPPFGTVFRDYQWFAPPERN
VQPMFRAWDVADHAPPAERVDIPDGLRAEWDREVADWQRVQDWADSEYERFLADDSDIDA
IVEGLDAHRRDRQRELAREVVDAVRAELVDRHRGIDPVGDIDAQLAMVAADIDRVAADLA
DRFAAADPPAVRSTVEDIRELLLAPDQPASFAAELRPGETPEDAIARLLAEHMRDDVPVF
TREQIQQIKDHLMRDEHRVRDHTDPGGGYVRRPMDRLADVAEAWHRLSTGRPLPQDFVLL
RDALAESEFLRRHPTAGWREANTHAVGLGHHWDADRPPLTDWRAGIPYAPAPLPVDPGWT
PPGERGTALPAPDGPETGPPGGRSAQLPPGETARPGDPATDGAPPHPGDRRVWPPEPPTP
RDSADTEADESTTQSRSPGPPADSQHSDPITEADAPHRPAETPSPESTTGSGQFSADQGH
RQARDRVEAARPVGGREPGEVPDSAEGPQVPDGGEPGDASATEGSAVPRTGSTLGAESES
ESESESESESESESESEPGVRHDGDDPDGAAGRRSTGPDAEEGAVRSEGDMRTDGDRRSD
GAPSDGAARTDGDARSDGDVRPDGDAGTDSDAGTDGDAGTDSDARPDGDARTEGNARTEV
DARTEGDARTDGGARTVGDARTEGNAPPEGDARPDGDARTDGQTRSEGDADQGDRARGAD
GGPHEPGAGEGPAASRPPRLPGSSMRSHIPHPPKDHDIELPPTGTIPPRDPGPWPLPDPP
TEPGPGDPPHDPPHDPPGSDCPPTPPATDCPLPPAADCPPPATDCPPPPGADSPPAQSTP
VPPAAPTPDPSCPPAPAEPDPPCPPDGTRPPGQQLPPGTCPSGGWSPGEVPSGGWSPGEV
PSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEV
PSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPPGGWFPGEV
PPDGWFPGAIPPGDRPSHPGPAGPGDVPGPGSQPPANGWQPPHAPQPNGAPPGTPHTPNT
PGRWNPPDSWLPPGAGPNGPTSGATPGTGAPTQGGERPDRWPANGSGGRPHGTPTPPPVQ
DQSQPATAAPMMPPGVPGMPGASAHPAGAARRRGADGYRPPDAAEPTTLLVRPHSGFGVS
AEFDPETGALQATSLRTGVESGVYGELAGVPVVLYRHDSRLRARVGQQSIDLDGPVTVNW
VAGAQRQTTFTISAGETVLCTLTYRTVPAELDIGRFIREVWADPDRRARMFA

BLAST