GenomeNet

>nge:Natgr_0070 K05308 gluconate/galactonate dehydratase [EC:4.2.1.140] | (GenBank) enolase superfamily enzyme related to L-alanine-DL-glutamate epimerase (A)
MGVDYADLRDPNAEYTMRDLSAETMQVTRERGGGRDVEITDVQTTMVDGNFPWTLVRIYT
DASIAGTGEAYWGAGAPELIERMAPFLEGENPLDIDRLTEHLVQKMSGEGSIGGVTVTAI
SGIEVALHDLVGKILEVPAYQLLGGKYRDEVRVYCDCHTEAEADPIACADEAERVVDELG
YDALKFDLDVPSGHEKDRANRHLRSPEIEHKTSIVEAVTQRVGSRADVAFDCHWTFSGGS
AKRLAKRLEEYDVWWLEDPVPPENHDVQREVTQSTTTPVAAGENVYRTHGQRRLLEEQAV
DIIAPDMPKVGGMRETRKIADLADLYYVPVAMHNVASPVATMGSVHVGAAISNTLAVEYH
SYELGWWEDLVEEDVIEDGYIEVPEEPGLGVTLDMDVVEEQMVEGEELFDEA

BLAST