GenomeNet

>ngv:CDO52_01410 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) aspartate aminotransferase family protein (A)
MAEQPTRLSPVLKQATPVLAARGEGVYIYDEDDRRYLDFTAGIGVTSTGHCHPRVVEAAQ
RQVGTLIHGQYTTVMHRPLLDLTERLGTVLPEGIDRLFYVNSGSEAVEAALRLARHATGR
QNAIVFQGSFHGRTMGAASLTTSGVKIRAGHGPLMPGAVVAPFPYAYRLGMSEDEAVAYT
LRELDYLLATVTSPKDTAAIFIEPVLGEGGYVPAPPAFLHGLRERADQHGILIVMDEVQT
GFGRTGKFWGHDHARVRPDIVITAKGLASGFPLSAIAAPAALMEQAWPGSQGGTYGGNAV
SCAAALATLDVIEEENLVDNAAHMGTRLHHGLSQVAEAHPVIGDVRGLGLMIGNEFTAPD
GSPDTETATRAHGIAADNGLLLLTCGPYGNIVRMIPPLIVNEEQIETATSIWAEAVKQAT
G

BLAST