GenomeNet

>nov:TQ38_018515 K07090 uncharacterized protein | (GenBank) sulfite exporter TauE/SafE family protein (A)
MLALVFFLVAVLFAAVGQAGATGYLAALGWAGYGPDCIRPVALSLNIIVAAVGTFQFARA
KKLSLRTFYPFGVLGFPFSIAGGLLTLPHAIYFPIVGGLLLLAAVQLARLAIQGHQTLDQ
ELPPPFLWALLTGAGVGFVSGLTGTGGGIFLAPILYLTGWVGSSRASGVTAAYNLLNSAA
ALAAVLATAPGFPTAMPIWLLAVAAGGGIGSTLGARFLPERALRALLAVVLLVSAVRFLL
G

BLAST