GenomeNet

>npr:108792937 K00710 polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41] | (RefSeq) WBSCR17; putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 (A)
MASLRRVKILLVLNLIAVAGFVLFLAKCRPITVKGGETFHEVHPRAEVTNLTSHGVSPIQ
EAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLTPEEGEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKKLKYPKELPQISIIFIFVNEALSVILRSVHSAVNHTP
VHLLKEIILVDDNSDEEELKGPLEEYVHKRYPGLVKVVRNHKREGLIRARIEGWKVATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRQFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKRKPYNNNIDFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDISERIALRKSLKCKNFQWYLDNVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPQENHTAIMYPCHGWGPQLARYTKEGYLHLGTLGSTILLPDTRCLVDNKKSKFPQLMD
CDKVKSTLHKRWSFIQNGAIMNKGTGRCLEVESRGNGGIDLILRSCTGQRWTIKNFIK

BLAST