GenomeNet

>nte:NEUTE1DRAFT131658 K18102 L-galactonate dehydratase [EC:4.2.1.146] | (RefSeq) NEUTE1DRAFT_131658; hypothetical protein (A)
MSDQEITITGWTTRDVRFPTSLDKTGSDAMNAAGDYSAAYCILQTDSKYTGHGMTFTIGR
GNDIVCSAINHVADRIRGRTLSSLVSNWGQTWRHLVNDSQLRWIGPEKGVIHLALGAVVN
ALWDLWAKVLGKPVWRIVSEMSPDEFVRCIDFRYITDAITPEEAVEMLKETEKTKTERIK
DAEANRAVPAYTTSAGWLGYGEDKMRALLRETMEKGYKHFKLKVGGSVEQDKRRLGIARE
VIGYDKGNVLMVDANQVWSVPEAIEYMKELKEFKPWFIEEPTSPDDILGHKAIREALKEY
GIGVATGEMCQNRVVFKQLLMSGAIDVCQIDACRMGGVNEVLAVLLIAKKYGVPIVPHSG
GVGLPEYTQHLSTIDYVVVSGKKSVLEYVDHLHEHFLYPSVIKDGYYQTPTEPGYSVEMK
ADSMDRFEYPGGEKSWWRTEEAKPILEGPKF

BLAST