GenomeNet

>oeu:111365241 K10144 RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27] | (RefSeq) E3 ubiquitin-protein ligase RZFP34-like (A)
MDCGLKHQMISHSSVEDEYIMDMGSENYGCSHYRRRCKIIAPCCNEIFDCRHCHNDAKNS
IEVDPLERHDIPRHEIKRVICSMCNTEQDVQQTCINCGTCMGKYYCSNCKFFDDDVSKNQ
YHCDKCRICRTGGKENYFHCDRCECCYSNLLKEAHICVERAMHHNCPVCFEYLFDTTRGI
TVLPCGHTIHLECVKEMERHFQYSCPVCSKSYCDMTRVWEKLDQEVASIPMPEMYQNKMV
WILCNDCGETSEVNFHVVAHKCLNCNSYNTRQTRGGHSSCASRISEMLMVESSHPFEGHI
QFTMLCLEINENHSFLTQFFMFEIVL

BLAST