GenomeNet

>oeu:111407430 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial isoform X1 (A)
MWRCVSRGLRIPSKKSTAGDSLCRLFSTQSNVGGSSYTVVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMGSDGSCQGVIALNMEDGTLHRFRAASTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLEVLMLMSPTINETTFFLQDLEFVQFHPTGI
YGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDIVSRSMTMEIREGRGVGPL
KDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGE
VVTIKGDDPDAVTSGLLAAGEAACASVHGSNRLGANSLLDIVVFGRACANRVAEIRRPGE
SQKPLEKDAGERTIAWLDKLRNSNGSLPTSNIRLNMQRIMQSNAAVFRTQETLEEGCQLI
DKAWESFHDVKLKDRSLIWNSDLIETIELENLLINARITMHSAEARKESRGAHAREDFTK
RDDENWMKHTLGYWENEKVRLAYRPVHMNTLDDEIESFPPKARVY

BLAST