GenomeNet

>oor:101270299 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (RefSeq) PTGS2; prostaglandin G/H synthase 2 isoform X1 (A)
MLARALLLCAALALCGAANPCCSSPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNMIMRYVLISRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRVLPPVPDDCPTPMGVKGRKELPDSKEVVEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTTGQSHGVDLNHVYGESLERQHKLRLFKDGKMKY
QIIGGEMYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKHEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDGQDYKYQQFVYNNSLLLEHGLTQFVESFTRQIAGRV
AGGRNLPVAVEKVSKASIDHSREMKYQSFNEYRKRFLLKPYKSFEELTGEKEMAAELEAL
YGDIDAIELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIIKTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL

BLAST