GenomeNet

>oor:101274585 K00509 prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1] | (RefSeq) PTGS1; prostaglandin G/H synthase 1 isoform X1 (A)
MSRRSVSLRFPLLLLLLPPSPVLPAAPGAPAPVNPCCYYPCQHQGICVRFGFDRYQCDCT
RTGYSGPNCTIPELWTWLRTTLRPSPSFLHFLLTHGRWFWEFVNATYIRDMLMRLVLIAR
SNLIPSPPTYNAAHDYISWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAELLSRH
FLLRRKFIPDPQGSNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLLGTHFQYRNRIAMEFNHLYHWHPLMPDSFRVGPQNYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGQIGGGRNTDHHVLYVAVEVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAADLEELYGDIDALEFYPGLLLEKCSPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKSSTFGGEMGFNLVKTATLRKLVCLNTKTCPYVSFHVPDPRQEDGPGVGRPSTEL

BLAST