GenomeNet

>opo:DSM2777_04305 K07058 membrane protein | (GenBank) inner membrane protein YhjD (A)
MLMPKEFDQKSSKATVTTQVAKTLDKANGVMSWFKAIPSVAHVIRAVDRFNDRLGSQFGA
AITYFSFLSLIPILMVSFAAVGFVLASNPDLLTELINKIVSSISDPNLATTLKNTVNTAI
QQRTTVGLTGLAIALYSGISWMGNLREAIRAQSREVWERNPQDQEKFYFRYLRDFISLTG
LVIALIVSLSFTSIAGAAQASIVRALGLDGIEWLRPVMTAIALSISIMANYLLFLWIFLV
LPRHKPKKKALLRGTLIAAIGFEVIKFVMTWTLPSLARSPSGAAFGSVIGLMAFFYFFAR
LTLFCAAWIATADYDGDTTVERKKPQP

BLAST