GenomeNet

>oro:101373969 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) HK1; hexokinase-1 isoform X2 (A)
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEGILITWTKKFKASGV
EGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKESLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQFSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFRLT
KDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNDGRMCINMEWGAFGDNGCLDD
IRTIYDRLVDEYSLNAGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLREETSS

BLAST