GenomeNet

>osa:4347508 K01783 ribulose-phosphate 3-epimerase [EC:5.1.3.1] | (RefSeq) ribulose-phosphate 3-epimerase, cytoplasmic isoform (A)
MAAAAAAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLR
KHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSL
RPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDG
GLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS

BLAST