GenomeNet

>paes:SCV20265_0861 no KO assigned | (GenBank) HDIG domain protein (A)
MFVQSLCGSWLDHPFWKRGGFLLDSQADLQRLRESAVKEVWIDASKGLDLPEEAAVSAAA
VLPVTMPAGPSPARVALEEEIRHAALLCSRAKAAVVSMFRDARMGQAIDTAHASDLVDEI
SASVLRHPNALLSLVRLKTSDEYTYMHSVAVCALMIALARQLELPDPLVREAGLAGLLHD
IGKMAVPDPILNKPGKLTDPEFGLVRRHPQNGARMLLDCRQVSALVVDVCLHHHERIDGT
GYPFGLAQEQISLLARMGAVCDVYDAITSDRPYKKGWNAAEAIRRMAEWNGHFDPQVFRA
FVKAVGIYPVGALVRLESGRLGVVLEQHGRSLLTPRVKVFFSARSKVPIPQQVVDLGRAG
QTDRIVGFEPAEAWNFRNLDEMWTGLAKSTGSYFDAGTGNP

BLAST