GenomeNet

>pana:BBH88_08790 no KO assigned | (GenBank) hypothetical protein (A)
MKSRLISAIYFMLDAFIISLVLVFVSKEAAALPVVWNWLLIALLASCISFMLFSRYSYRL
VWVIGISIVAVFGMWITGISLWLALILGMLTIYLLHGRYSVLNEEFNHGHHFLMKFTVVF
SICWIILLLNPEEQTGRLLFTIVPVVVLFYVASHLLYGYLHSREDGAKLSQAAGAFGIVF
SISALAAISTFFVAEEVRKLVGWAAGGAIRIVFWPLALLLEQASKFLSGLSTEGEMQETI
DKLGPEEKAAQNDTTASETMPTDFPVEMLLGIVVLVCVIALVLWLRKVKPDSEAPMQESL
SSIKRHDHQSSEQHMPTTYASCGTNMNLHQIREVFRDLEQMAKEQDLGRKNYETVREWIT
RVQWDVTDSFYRTYDRVRYGDKQLPGSQATDFINEIEKIKGKYLKENV

BLAST