GenomeNet

>panp:PSNIH2_08195 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) alkyl hydroperoxide reductase (A)
MLDTTMKNQLKAYLEKLTKPVELIATLDDGAKSAEIRELLGEIAELSDKVSFREDNALPV
RKPSFLITNPGNTTGPRFAGSPLGHEFTSLVLALLQTGGHPSKETQALLEQIRQLDDDLH
FETYYSLSCHNCPDVVQALNLMAILNPRISHTAIDGGVFQSEIQDRNVMGVPAVFLNGKE
FGQGRMSLAEIVSKVDVNADKRAADELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVSEYAIDVIDSQSASKLVPAKVEG
GLHAIETASGAVLKSRSIIVATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPTMKADAVLQEKARSLENVDIILNAQTLEVKGD
GSKVTSLEYKDRVNETVHQIDVAGIFVQIGLLPNTTWLDGAIERNQMGEILIDAKCETNV
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPVG

BLAST