GenomeNet

>pbi:103067160 K04417 mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25] | (RefSeq) MAP3K9; mitogen-activated protein kinase kinase kinase 9 isoform X1 (A)
MLEVDFSELILEEIIGIGGFGKVYRAVWFGDEVAVKAARYDPDEDISEAIENVHQEAKLF
AMLKHPNIIALKGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIAEGMNY
LHEEAIVPIIHRDLKSSNILILERVENGDLSNKNLKITDFGLAREWHKTTKMSAAGTYAW
MAPEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLSLPIPSTCP
EPFTRLMEDCWNTDPHSRPSFANILNKLTNIEESGFFEMPKESFHSLQEDWKIEIQEMFD
QLRAKEKELRTWEEELKQAAVQQKNHEELLRQREQELAEREIDILERELNIIIHQLCQEK
PRVRKRMGKFKKNRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKNLINNCASPPASPTI
IPRLRAIQLTPGESSKTWGRSSVFQKDEEGEEEKRGQKKKGRTWGPGSLCNKELTSSEDG
LKSLADGARHWSSSAPNLGKFQRTIVPFPGFASLIEMDNEDNDSLNDRESKVQQSPGFNQ
SYLCIPFQKNDDWDAQSSDPNEETTPMNSSTSTPQLTPTNSLKRGGSQYKQCQLAFLGCG
AVLAAAGLGFDLLEAGKCQLLTQEDQDVSKEEKKKRESIFQRAGLSRRSTSPPSRKVFKK
EEPTFLLGEPSSSLTLLSLSSISECNSTRSLLHSDSDEIVVYEMPVSPVTVKAPLPIVSN
PLVNIRVERFKQNPNQSLTPTHVTLSSEAQQQKHRRTPSDGAIKLSDLVSNADSSSNSPT
GVLEAAVAALLKSSPHCFLFMPDCLKRSGHCWTWTLKVRVRTAQCRYAEQNSERINLQHM
NSSKNFGPSMKFTRGW

BLAST