GenomeNet

>pcd:C2E16_04580 K05365 penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4] | (GenBank) mrcB; penicillin-binding protein 1B (A)
MSGNDREPIGRKGKQPKPPRKSGGQGRRREEYNDEQNDDYQEERPVPRKGKGRPPRSKKR
KWLGWLIKLFIVGVVVMAAYGVYLDSAIRSRIDGKVWQLPAAVYGRMVNLEPGMAYNKKE
MIALLEGTQYRQVTRMTRPGEFTVQANSIELIRRPFDFPDSKEGQIRARLTFSNDALSEI
KNLDNGRDFGFFRLDPRLITMLQSPNGEQRLFVPRAGFPDLLVDTLIATEDRHFYEHDGI
SFYSIGRAFLANITAGRAVQGGSTLTQQLVKNLFLTNKRTLWRKANEAYMALIMDARYGK
DRILELYLNEVYLGQAGNDQIRGFPLASLYYFGRPVDELSLDQQALLVGMVKGASLYNPW
RNPKLALERRNLVLRLLQQQKVIDQELYDMLSARPLGVQPKGGVITPQPAFMQMVRGELQ
AKLGDKVKDLSGVKIFTTLDPVSQDAAEKAVEEGIPALKKQRGLKDLETAMVIVDRFSGE
VRAMVGGADPQFAGYNRAMQARRSIGSLAKPATYLTALSQPDTYRLNTWIADEPIALKMS
NGQVWKPQNDNHRFSGKVMLVDALTNSMNVPTVNLGMTLGLDNVINTWTKLGLPKDQLHP
VPAMLLGALNLTPVEVAQAFQSIASGGNRAPLSAVRSVIAEDGSVLYQSFPQAERVVPAQ
AAYLTLYTMQQVAARGTAHALGAKFPNAHLAGKTGTTNSQVDSWFAGIDGKEVAITWIGR
DNNQPAKLYGSSGAMQLYRRYLENQSPMPLTLTPPEDIASMAVDSAGNFVCNTGSSGWRT
LPVWTTDADALCQQQMQQIQQQQMQQQQLEQQQQPQQPQQQPPQQQSGDGVAGWIKDMFG
GD

BLAST