GenomeNet

>pfs:PFLU_4601 K12297 23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264] | (GenBank) conserved hypothetical protein (A)
MLKSLDCPMSDRFELFLTCPKGLEGLLIEEAVGLGLEEAREHTSAVRGMADMETAYRLCL
WSRLANRVLLVLKRFPMKDAEDLYHGVLDIEWADHMVPDGTLAVEFSGHGSGIDNTHFGA
LKVKDAIVDKLRTPAGERPSIDKINPDLRIHLRLDRGEAILSLDLSGHSLHQRGYRLQQG
AAPLKENLAAAILIRSGWPRIAAEGGALTDPMCGVGTFLVEGAMIAADMAPNLNRELWGF
TTWLGHVPALWKKLHTEATERAAIGMNKPPLWVRGYEADPRLIQPARNNIERAGLSHWIK
VYQGEVGTFEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVF
TGAPDLGKRMGIRSHKQYSFWNGALPCKLLLIKVNPDQFVTGERRTPEQRQAEREQAAYD
QAPVEPQERQYNKNGNPIKPAPAPVVEQARLSEGGQMFANRLQKNLKLLGKWAKREGVDC
YRVYDADMPEYSMAIDLYHDWVHVQEYAAPKSIDPEKASARMFDALAAIPQALNIDKSRV
VVKRRERQSGTKQYERQSAQGKFTEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQKEA
AGKRFLNLYCYTATASVHAAKGGARSTTSVDLSKTYLDWARRNFSLNGFSDKNRLEQGDV
IAWLEASRDEFDLIFIDPPTFSNSKRMEGIFDVQRDHVQLLDLAMARLAPGGVLYFSNNF
RKFVLEDNLSERYAVEEISDKTLDPDFARNAKIHRAWKITAR

BLAST