GenomeNet

>phei:NCTC12003_01506 K01782 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3] | (GenBank) fadJ; Fatty acid oxidation complex subunit alpha (A)
MEQHSTTEVKTDITEPAFTLEIYDENVGVIFIDVPNEKVNTLKAEFAEQFLAILHKAQST
SGLKGLVITSGKKDNFIAGADISMIANCETKAQASELSTEGHALFDKIDNYPLPIIAAIH
GACLGGGLELALACHARVCSSDDKTRLGLPEVQIGLLPGSGGTQRLPRLVGIPHALDLML
TGRQLKAKQAQKIGLVDDVVPTTILLDVAIKMVKKGGVHRPAIHWQQRLLSSKFLRNQVF
KSAKQKALSKTKGHYPAPEKIIQVVKIGMNKGLKAGYAEEAKAFGELVMTPESAALRSLF
FASTALKNEAGAQATPLKIKQIGVLGGGLMGGGIAYVSASQGKLPVRIKDISDKGVTQAL
RYSWDLLTQRVLKRRLLSRERSAIMSRISGTLSYQGLDKSDVVIEAVFEDLALKQKMVAE
VEKMSAGSAIFASNTSSLPIHQIAAESTHPEKVIGLHYFSPVDKMPLVEVIPHEHTDAKT
IATVVALAKRQGKTAIVVGDDAGFYVNRILAPYLCEAAECLVQGEPIEHIDNALVNFGFP
VGPFNLLDEVGIDVGTKILPILVERFGNRFKAPEALDKVVKDDRKGKKNGRGFYEYGHSS
SRLIFWKKSSKRQVDKRIYSLINIHVESKQSKTEIAQRCVMLMLNEAARCLDEKIIRSAR
DGDIGAVFGIGFPPFFGGPFRYMDSLGIAKTVETMKMLSERYGDKFQPCDLLCHMAENNT
NFYQ

BLAST