GenomeNet

>phi:102105403 K19523 carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21] | (RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform-like (A)
MAEAHQAVAFQFTVTPEGLDFQLSREAVRQLYLAAVHSWKKRLVRAKNSFLSGVYPASPS
SWMVVVLATAGSCYCHVDPSLGLIGRIQSWLPHGEALSPEARTAVSTVLFSTGAWLGAVL
LFRSLLRLLLSYHGWMFEPHGRMSRRTRLWIGATTVPAAAARRSPRVPSPQYLESVRPLL
DEERYQEMVALAKEFQEKTAPRLQRYLRLKSWWTTNYVSDWWEEYVYLRGRSPLMVNSNY
YAMDFLYVTPSPIQAARAANVVHSILLYRRRLDRGEIPPMMALGVVPMCSYQSERMFNTT
RIPGKETDSLLHLADSKHLAVYHKGRYYKVWLYYGGQLLAPAELEMQFQRILDDPSPPQP
GEERLAALTAGERAPWAEARARFFSRGPNKAALDAIERAAFFLTLDEEEHGHDPRKPGCM
DAYAKSLLHGRCYDRCFMLATDTFHLGYTEGGHCKGDPRRQLGPPQRLQWDIPAEAVAAI
EASLGVAQVQGVAAIDASLGVAQVQGVAAIDASLGVAQVQFMLATDTFHLGYTEGGHCKG
DPRRQLGPPQRLQWDIPAEAVAAIEASLGVARALAEDVDFCCFLFTTFGKGLIKRCRTSP
DAFIQIALQLAHFRDKGSFCLTYEASMTRLFREGRTETVRSCTCESTAFVRSMADPRRS

BLAST