GenomeNet

>phu:Phum_PHUM530140 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase, flavoprotein subunit (A)
MVQNVPDQIALFFLFLCVQGQYQVIDHEFDAVVVGAGGAGLRAAFGLVAEGFNTAVITKL
FPTRSHTVAAQGGINAALGNMEQDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIEL
ENYGMPFSRTDEGKIYQRAFGGQSLNFGKGGQAHRCCCVADRTGHSLLHTLYGQSLRYDC
NYFIEYFALDLIMDKNEKTCKGVIALCLEDGSIHRFRAKNTVLATGGYGRAYFSCTSAHT
CTGDGTAMISRAGLHNEDLEFVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYA
PVAKDLASRDVVSRSMTIEIREGRGVGPEKDHVYLQLHHLPPEQLHTRLPGISETAMIFA
GVDVTREPIPVLPTVHYNMGGIPTNYKGQVVTVDGVGNDVVVNGLYAAGECACSSVHGAN
RLGANSLLDLVVFGRACAKTIASENKPGEKTMELSDSDGEDSVTNLDNVRYANGSISVAD
LRLKMQKTMQNHAAVFRTQETLAEGCEKMAKMYKELKNIKVYDRSLIWNSDLVEGLELQN
LMINALQTIIGAENRKESRGAHAREDFKDRIDEYNYSQPLENQQPKSIENHWRKHTLTCM
NVDTGEVTIEYRPVIDKTLDENECKTVPPAVRSY

BLAST