GenomeNet

>plf:PANA5342_3590 K01924 UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8] | (GenBank) murC; L-alanine adding enzyme, UDP-N-acetyl-muramate:alanine ligase (A)
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYHISGSDLAPNPVTQNL
INLGATIYFNHRPENVTDASVVVVSSAVAQDNPELVAAREQRIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEGGLDPTFVNGGLVKAAGTHARLGSSRYLIAEADESDA
SFLHLQPMVAVVTNIEADHMDTYQGDFENLKQTFINFLHNLPFYGRAVMCVDDAVIRDLL
PRVGRQITTYGFSDDADFRIEAFEQRGAQVHFSLIRQDKAPLQITLNAPGRHNALNAAAA
VAVASEEGIEDSAILAALESFQGTGRRFDQLGEFPTEPVNGQPGTAMLVDDYGHHPTEVD
ATIKAARAGWPDKKLAMVFQPHRYTRTRDLFDDFANVLSQVDVLLMLDVYAAGETPIPGA
DSRALCRAIRHRGKVDPILVPEHDALVEMLAPLLSGNDLILVQGAGNVGKVARKLAECKL
QPARKVEGRHD

BLAST