GenomeNet

>pop:7468572 K01657 anthranilate synthase component I [EC:4.1.3.27] | (RefSeq) anthranilate synthase alpha subunit 2, chloroplastic isoform X1 (A)
MCEVSQFPFSLPNKFSLKTMDKTLAVTHRLLPLSFRLPAASSVNFNVRLSRSSSRSLDLV
GSRSHGCTLKCSASTLDNQVARFQEASKNGNLIPLYRYIFSDHLTPVLAYRCLVREDDRD
APSFLFESVEPGLDASTIGRYSVVGAQPRMEIVAKENMVTIMDHYEGRRMEEIVEDPMEV
PRKIMEGWEPQLIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSGAPPDDRNLPDVHLGL
YDDVIVFDHVEKKACVIHWVQLDRFSSVKEAYEDGMNRLENILSRVHDIAPPRLPAGSIK
LFTRLFGPKLENSSMTSEEYKDAVLQAKDHILAGDIFQIVLSQRFERRTFADPFEIYRAL
RVVNPSPYMTYLQARGCILVASSPEILTRVKKEKITNRPLAGTVRRGKTPKEDLMLEKEL
LNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDNLT
RWDVLRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIV
FPTSTRYDTMYSYKDVNTRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAE
SAFLKK

BLAST