GenomeNet

>pop:7481744 K17398 DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37] | (RefSeq) uncharacterized protein LOC7481744 (A)
MDCNRVLPDQPADEEEEEPEEEESRVSEVRSERSFDFAVKDEERQDRLALGDYRSLWSEF
DDFVANEDNGAMTGTSRALIYGFEVGDMVWGKVKSHPRWPGHIFNEAFASSSVRRTRREG
HVLVAFFGDSSYGWFDPAELIQFDVNFAEKSQQTNSRTFIKAVEEATDEASRRSALGLAC
KCRNKYNFRPANVPGYYVVDVSDYEPGGVYSASQIMKARDGFKPGETLAFVKQLAVGPHG
CDQESFEFIKNKARAFAFRNAVFEEFDETYAQAFAVQSSRPSNDTAKVPNQLAKEPTRAP
LSGPLVIAEAPGGEKSSKKPIKVKDHSKKGNYLLKRRDEPSELRAFEIVQRQAGSSSLAV
YVEAGSSAVEAGDFVLQKRASTPHISAKHEQSVLITKEDVDSSEDGAGKAALVLDHAPGD
ANVSLDKKGAMQEIEGEPGSDVAVGLMSTGWSDLPGKEQLKGVSDCTYEESAKASGSNQV
SQQNELSFSARAEVDSGLSKLQDGEPGSLLSPLNATQSVGTSTGSGVKKVKVIKRPVGDT
SSQKSIMGGKRKKEIRAETNPDRPKKRLATGKGEEVRISLGKSTHISFSPGEDSQLNSQK
KDGIEFELPQLLSDFLALALDPFHVAERNSHSVTMHFFLRFRSLVFQKSLVLSPPSETEV
VEVRGTKSLSSIGASDYSASEDTRGLIPSKPAKLLVRPNDPTKAGRKRLPSDRQEEIAAK
RQKKIIQLKSLAAEKKAQRTLDTLGAEGKETVARQRAEGKQTAATQRVEGKQPVAQPPRK
SVKPDSFKKMEPPVRAIEPTMLVLRFPPETSLPSAAQLKARFARFGSIDQSAIRVFWKSS
QCRVVFRRKLDAQAALKYALGNKSLFGDVNVRYNIREVGAPASEPPESDKSRDDTFVDAA
QAEDPLADWQAVAFAHQPPSQSTVQLKSILKRPNGDEAAPVTGGNGSRGNRVKFMLGGEE
TNSGEQMMVGNRNNFNNNASFADGDAPTTSVAMGFSSKNIQKVFPPSPLPILPLPTQFAK
APLNYSQHHTEVAPRNSHNFNTPPPSAGPSTPSIDISQQMLSLLTTCNDVVTSVSGLLGY
VPYHPL

BLAST