GenomeNet

>ppol:X809_31800 K12132 eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1] | (GenBank) serine/threonine protein kinase (A)
MIGHLLGGRYEIIERIGGGGMALVYKAQDILLNRNVAVKVLRQQFVHDEEFIRRFRREAQ
SAASLSHSNVVSIYDVGQEDEIHYIVMECIEGKNLNEIIKERAPLQVDEAVRIASQICDA
LEHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVVTGEKSDLYSLGIVLYQMLTAQLPFLGESPISVALKHLQEEFEEPRKINPLIPQSV
ENVILKSMRKNPEERYQSADEMLKDLETCLLPGRRNESKLEFTHLDDEDQTRVIPAIKPQ
QLGMSSSGDDVPAQPRESEQLSSKQSSKKNRKKAILWVTLVLVLLLCMGGVVYYVQSVLV
VPEVKVPGVLTQTEDQAKVNLSKAGLLIEEPIQHEYKEGIAPGVVFYQSYPADSLVKEGT
KISLKVGIAKPLTPMPDVKGQSYENAVKLLTAQQIKETQIQQNEQFSDQAAGTVLSQTPA
ANEPFDKDSVQVVLTVSKGADTVKMPSLVGKTQNQAENEVKKAGLKVGSIKEEFSYEQEK
GRVTKQWPSEAGSELPPNTEITFYVSTGYPPEAITLPFNVPVAPKEEGKNSKIRITYTDA
RGENQEWGSRTINTTQMFTINLLMAPNKDSVVSVFRDGDFIDTYPVSYIEAKNGTVTMPQ
IAPPAGTSPTDTPDGTSSQNGSGNGEEGDSGGSSNDTGNSGGDSNNQEGTGGNGDPSAFV
PGTNSTGSTRSELAVSHKNNPGHAKKEKVIEAVQHQ

BLAST