GenomeNet

>prw:PsycPRwf_2235 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase (A)
MLDQGLLDAVKSYSENMTHPIRFVIGQGDHPKKAELVDFLKQIAGTTDKINFDDAATDDS
LPSPISFKIISEKDSGHNETGIVFSGIPGGHEFTSLILAILQAGGHTLKLDDSIQKMVKR
IAQPLQFQTYVSLSCHNCPEVVQALNQFALLNDGISNEMIDGGLFQEQVEANNIQGVPAV
FLNGKPFLNGKVDTARIIDKLQEQYPDLLAAPSEDDAEQLERQDVTVIGGGPAGVASAIY
SARKGLKVTIVADRIGGQVKDTQSIENLISVPLTTGSELSANFEKHLAEYDITIKEHVSV
KQLSETEDENYRIQLNTSEQFETRSIIIATGAQWRKLNVPGEEENIGSGVAYCPHCDGPF
FKSKDIAVIGGGNSGIEAALDLAGIVKNVTVFEFADDLKADQVLINKAKSIDNINIITSA
ATKEIKATDGKVTSIVYEDRTTGDIKEQDLSAVFVQIGLVPNSDFVKGFVDVNRFGEIEI
DEACKTDRRGIFAAGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ

BLAST