GenomeNet

>psb:Psyr_2510 K00874 2-dehydro-3-deoxygluconokinase [EC:2.7.1.45] | (RefSeq) carbohydrate kinase PfkB (A)
MSLPRVALIGECMIELQQHADGSLRQSFGGDTLNTAVYLSRLLGERAKVDYVTALGDDSF
SDAMCRIWADEGIGLGKVQRLPGRLPGLYCIQTDANGERRFLYWRNEAAVRDCFMTPAAE
PILAALASYDVLYFSGITLAVLGEQGRAKLLEALARARQRGVRVAFDNNYRPRLWASVEQ
AREAYLACLQHVDLALLTEDDEQALYGYADSEQLLAAYRGRGIGEIVVKRGAQSCLVEAG
GERFDIAAQKVERVVDTTAAGDSFSAGYLAARLTGQHPLQAAEAGHRLASIVIQHPGALV
PKSVMPV

BLAST