GenomeNet

>psp:PSPPH_2745 K02031 peptide/nickel transport system ATP-binding protein | (GenBank) dipeptide transporter dppD-like protein (A)
MTHEQSLLNVQGLRIGFPGSGPELIEVVKGIDFTVGTEKVALVGESGSGKSLTARALLGL
VARPGQVTAEHMSLAGDDLRSLTAKQWQGLRGTRLSLVLQDPRYSLNPVLRVGTQVEEAL
VLHTRLGRRERREKVLDMLEAVGLPNPLALYDSYPHELSGGMGQRVMLAAMLINDPRLLI
ADEPTSALDSDLRDQILELILGLVEQRNMGLLLISHDLPLVAKYCDRALVMYRGRIVDRC
NAAELATASNPYTQTLWRCQPSALTYGQALATLDRKLMEALP

BLAST