GenomeNet

>pspi:PS2015_2174 K05515 penicillin-binding protein 2 [EC:3.4.16.4] | (GenBank) Penicillin-binding protein 2 (A)
MAHKFRLDAHKQEIQVFHRRVIFAAGFVALLVLVLAGWMINLQFFNHDYFSARSDGNRLH
SQFIPPTRGLIYDRNGRLLADNRPIFNLTVVRETATDFDQSLELLRKIVNLTDDDIQQYQ
TRLSRRAVPHTSVPLKIKLSDDEIARVAVSQHKLPGIAVEAQLLRYYPYGEAMAHALGYV
SEINREELQAMSEEQARNYRGTNQVGKTGIEKNYESYLHGTVGFETVEKNNRGRVTRVLG
RTDPIPGKDIQLHLDLPLQLAAEQALGERRGAIVAIDPATGGVLAMVSKPDFDPNLFVTG
ISRDQLAAMNRSRYSPMFNRAINPRVPGSTIKPIVGLAGLYHGIVDQEFVINDPGFYRLP
GRSRPYYDWTWWVDKSGHGPVDLERAIYQSCNTYFSHIAVELGIDTLHDYLLTWGFGSNA
ALDIPDANPGLVPSPAWKRETRGEPWYPGETPPEGFGNGMFQATTLQMASAAATIANHGV
MKRPRMLKALNDGTDDDFADIIFGDEDVLQPLLPSPEDIAYVRKAMEHTVSKPYDREHRR
HEGTAYPYVHGAEPLAYPMGGKSGTAQVVGVQVDARGNRIDPEEINQDHLNHAMFIAFDA
SPQSRIAVAVYVENGEGGSSVAGPLAREVLDAYLLPILENEKLDEEAMLLTSSH

BLAST