GenomeNet

>pss:102454892 K11217 Janus kinase 1 [EC:2.7.10.2] | (RefSeq) JAK1; tyrosine-protein kinase JAK1 isoform X1 (A)
MQYLNVKEDCKAMAFCAKLRNSKKSEVTTEAREQGLEIVFYLQEKPPIWYTSGEYTAEDL
CIEAAQKCAVSPLCHNLFALFEESRKLWYAPNHVFKIDDKTALRLYYRMRFYFTNWHGTS
ENEPSVWRHSPKKPKNSYEKKLVPYGAPILDTSPKKQKNSYEKKLVPDGTPILDANSLEY
LFAQGQYDLVKCLAPVRDPKNDQEVHEIENECLGMAVLAISHYAIKKNMKLPELPKDISY
KRYIPETLNKTIRQRNILTRIRINNVFKDFLKEFNNKTICDSSVSPHDLKVKYLSTMETL
TKHYGAEIFETSSLQISTENEKHGFNLGDNGIMPQYEVMVTGNNGIQWRRKPNVIQPERE
KHNKLKRKKMDSKNRKGEEKNKSREEWNSFSYFPEITLLVIKESTININKQNHEKMEIKL
SSHEEALSFASLVDGYFRLTADAHLYLCTDVAPPLIVHNIRNGCHGPICTEYAINKLRQE
GNEEGMYVLRWSCTDFNHILMTVTCSEISQQRLNESVQYKNFQIEVTKDGCFLHGPNKFF
PSLKELMDHLKGQTLRTDNISFTLKRCCQPKPKEISNLLVATKKGQEWHPVCPLGQLSFH
RILKEEILQEEHLGRGTRTQIYSGILNYKADENDGYQDEKEKKVLLKVLDPSHRDISLAF
FETASMMRQICHKHIVFLHGVCVRDVENIMVEEFVEFGPLDLFMHRKSDVLTTPWKFKVA
KQLASALSYLEDKELVHGNVCTKNILLAREGIDHEYGPFIKLSDPGIPITVLSRQECVER
IPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEAPLKDKTLAEKERFYEGHFMLVTP
SCKELADLMKQCMNYDPNQRPFFRAIMRDINKVEEQNPDIVSEKTPFAEVDPTLFEKRFL
KRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHE
NIVKYKGICIEDGGSGIKLIMEFLPSGSLKEYLPRNKSKITLKHQLRYAVQICKGMDYLG
SRQYVHRDLAARNVLVESENRVKIGDFGLTKVIETNKEYYTVKDDLDSPVFWYAPECLLQ
SKFYIASDVWSFGVTLYELLTYCDSESSPMAEFLKMIGPTQGQMTVTRLVRVLGEGKRLP
RPPNCPEEVDQLMRKCWINNPGDRTTFQNLIQGFEALINKL

BLAST