GenomeNet

>pvm:113823021 K03648 uracil-DNA glycosylase [EC:3.2.2.27] | (RefSeq) uncharacterized protein LOC113823021 (A)
MITRLSRLLRKNLIFGPSNNSPPPLFAHRREMATQKLIANFFKPVNKRVSGETQDTQVAK
KPKIAEEKENAEEGNNAPGSPTRSSAPELNTCLSPEQKDRMQKNKLKAEIKQTSRKFGAL
HENIGTSWFSALKTEFSKPYFEKLSLFLDGERKRSTIFPPAEQVYSWTHHCELRDVKVVI
LGQDPYHGPRQAHGLCFSVQKGVPPPPSLLNMYKELESDIEGFERPSHGHLIGWAKQGVL
LLNACLSVRAHNANSHKDQGWEKFTDSVIKAVSDRNKGVVFLLWGSYAQKKAAVVDKKKH
HLLNTTHPSPLSAHRGFLGCKHFSKCNEILKKQGKKPIDWNYLPLEM

BLAST