GenomeNet

>pxb:103960087 K20347 p24 family protein beta-1 | (RefSeq) transmembrane emp24 domain-containing protein p24beta3-like (A)
MEKQKRFETAKICVAYSVLMSFIGNGNVATALSITVMELECVLEQVLYEGDTVSGNFVAI
DHDIFWSSDHPGIDFTATAPGGTTVFSLKGTSGDKFAFKAPKSGLYKFCFRNPVSTPETV
SFYIHVGHIPNEHGLAKDEHMDPLNIKIAELREALEAVTTEQKYLKARDARHRYTNVSTN
KRVIYFTLAEYLVFAGASALQVLYIRNLFSKSVAYNRV

BLAST