GenomeNet

>pxb:103965603 K04392 Ras-related C3 botulinum toxin substrate 1 | (RefSeq) rac-like GTP-binding protein ARAC3 (A)
MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD
TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPSVPIILVGTKL
DLRDDRQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP
PKQKKKKKRKAQKACSIL

BLAST